- C10orf53 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90476
- 0.1 ml
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- C10orf53
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: MPKNAVVILR YGPYSAAGLP VEHHTFRLQG LQAVLAIDGH EVILEKIEDW NVVELMVNEE VIFHCNIKDL EF
- Human
- chromosome 10 open reading frame 53
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF
Specifications/Features
Available conjugates: Unconjugated